General Information

  • ID:  hor002015
  • Uniprot ID:  O54713
  • Protein name:  Gonadoliberin-1
  • Gene name:  GNRH1
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0010468 regulation of gene expression; GO:0045471 response to ethanol; GO:0048545 response to steroid hormone; GO:2000354 regulation of ovarian follicle development; GO:2001223 negative regulation of neuron migration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QYWSYGVRPG
  • Length:  10
  • Propeptide:  MGLIPKLLAGLVLLTLCVENGSGQYWSYGVRPGGKRNIEPLVDSFQEMAKEIDQLAEPQHFECTLHQPRSPLRDLKGALESLMEEETGQKKI
  • Signal peptide:  MGLIPKLLAGLVLLTLCVENGSG
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Gnrhr
  • Target Unid:  Q8CH60
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O54713-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002015_AF2.pdbhor002015_ESM.pdb

Physical Information

Mass: 137303 Formula: C57H77N15O15
Absent amino acids: ACDEFHIKLMNT Common amino acids: GY
pI: 9.17 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 2
Hydrophobicity: -105 Boman Index: -1589
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 29
Instability Index: 186 Extinction Coefficient cystines: 8480
Absorbance 280nm: 942.22

Literature

  • PubMed ID:  NA
  • Title:  NA